PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 320480
Common NameARALYDRAFT_320480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 348aa    MW: 39174.3 Da    PI: 4.7801
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
320480genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.81.4e-141963448
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     W +eEd+ll+d+v+q+G  tW+ ++++ g+  t+k+c+ rw++yl
           320480 19 WRQEEDKLLKDYVNQHGDVTWTDVPKHTGLSHTAKSCRFRWLNYL 63
                     9****************99************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.7821167IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-151365IPR009057Homeodomain-like
SMARTSM007173.9E-101565IPR001005SANT/Myb domain
CDDcd001672.12E-91963No hitNo description
PfamPF139211.4E-131980No hitNo description
SuperFamilySSF466897.59E-201993IPR009057Homeodomain-like
PROSITE profilePS500906.15664101IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.8E-126697IPR009057Homeodomain-like
SMARTSM007174.968121IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MIQDQAYDLL TMKKNYTIWR QEEDKLLKDY VNQHGDVTWT DVPKHTGLSH TAKSCRFRWL  60
NYLRPGLKRG PFTEEEEQRV IELQAVLGNK WAQMSKEKLK RLGLPVYPDK VRKQAISTAL  120
RNGLKIDLLD AQDLLMVDNV EKPDAALNNL PLNQFSSYYQ SMLANVQPRE PETTFPFTNG  180
YVMNEQNPNL LNYLSVDSTQ EQLPDIHLFG NATCSSPPMP LIHGVGNLEL PSFQGFNAHE  240
VPSSFGAEQY NPMMNLEPDN TLVQPPLIGQ TPTDFPSSFY DELLESVVYG SVGERPKTDT  300
SSELPPFPSS LLSHTEVTPP IANTIGKLSF TSLFVYSIQE VSSNLYA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1419961086B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATU269341e-130U26934.1 Arabidopsis thaliana DNA-binding protein (MYB104) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002880851.10.0hypothetical protein ARALYDRAFT_320480
SwissprotQ9SM271e-157MY104_ARATH; Transcription factor MYB104
TrEMBLD7LFE90.0D7LFE9_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_40005370.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91982138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26950.11e-154myb domain protein 104